Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 386 results

Page 1 of 26

(reset)

Cullin 4B (CUL4B) Rabbit Polyclonal Antibody

TA590752

USD 482.00

In Stock

Rabbit Polyclonal CUL4B Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

KEAP1 Rabbit Polyclonal Antibody

TA590238

USD 482.00

In Stock

Rabbit Polyclonal KEAP1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

BRCA1 Rabbit Polyclonal Antibody

TA310042

USD 565.00

In Stock

Rabbit anti-BRCA1 polyclonal antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).

1 / 2

2 / 2

Previous Next

ERCC8 Rabbit Polyclonal Antibody

TA329326

USD 539.00

5 Days

Rabbit Polyclonal anti-ERCC8 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

DDB1 Rabbit Polyclonal Antibody

TA308812

USD 625.00

5 Days

Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse (Predicted: Bovine)
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531)

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Parkin (PARK2) Rabbit Polyclonal Antibody

TA324839

USD 580.00

2 Weeks

Rabbit polyclonal Parkin Antibody (C-term)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin.

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

UBE2S Rabbit Polyclonal Antibody

TA590247

USD 482.00

In Stock

Rabbit Polyclonal UBE2S Antibody

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501).

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

PML Protein (PML) Rabbit Monoclonal Antibody [Clone ID: OTIR1H2]

TA591018

USD 516.00

In Stock

Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2

Applications	SISCAPA
Reactivities	Human
Conjugation	Unconjugated

• 

SYVN1 Rabbit Polyclonal Antibody

TA324314

USD 580.00

5 Days

Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1).

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

XIAP Rabbit Polyclonal Antibody

TA306170

USD 570.00

In Stock

Rabbit Polyclonal XIAP Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOCS1 Rabbit Polyclonal Antibody

TA321592

USD 380.00

4 Weeks

Anti-SOCS1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 200-211 amino acids of Human suppressor of cytokine signaling 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOCS1 Rabbit Polyclonal Antibody

TA321593

USD 380.00

In Stock

Anti-SOCS1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

UBE2L3 Rabbit Polyclonal Antibody

TA308758

USD 625.00

5 Days

Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)

Applications	IF, IHC, IP, WB
Reactivities	Human (Predicted: Xenopus, Pig, Chicken, Bovine, Rhesus Monkey, X. tropicalis)
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036)

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Mps1 (TTK) Rabbit Polyclonal Antibody

TA314651

USD 380.00

4 Weeks

Rabbit polyclonal TTK (Ab-676) antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V).

1 / 3

2 / 3

3 / 3

Previous Next

CDC20 Rabbit Polyclonal Antibody

TA321318

USD 380.00

In Stock

Anti-CDC20 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

1 - 15 of 386 results

Page 1 of 26