Antibodies

Jump to Filters
View as table Download
beta Actin (ACTB) Goat Polyclonal Antibody
AB0145-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA309096

USD 545.00

2 Weeks

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA890010

USD 348.00

In Stock

Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Mouse, Monkey, Dog, Rat
Conjugation Unconjugated
Immunogen ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB
Collagen I (COL1A1) Rabbit Polyclonal Antibody
R1038B

USD 795.00

2 Weeks

Collagen I (COL1A1) rabbit polyclonal antibody, Biotin

Applications ELISA, FC, IHC, IP, WB
Reactivities Bovine, Human, Mammalian, Mouse, Rat
Conjugation Biotin
Immunogen Collagen Type I from Human and Bovine placenta.
Collagen II (COL2A1) Rabbit Polyclonal Antibody
TA311649

USD 380.00

In Stock

Rabbit polyclonal Collagen II antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Collagen II.
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA309097

USD 545.00

2 Weeks

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA336689

USD 575.00

5 Days

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].
Fibronectin (FN1) Rabbit Polyclonal Antibody
TA336854

USD 650.00

5 Days

Rabbit Polyclonal Fibronectin/Anastellin Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made toward the C-terminal region of the human Fibronectin protein (within residues 2250-2300). [Swiss-Prot P02751]
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA345667

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
beta Catenin (CTNNB1) Goat Polyclonal Antibody
AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.
Myosin Light Chain 2 (MYL2) Rabbit Polyclonal Antibody
AP02680PU-N

USD 405.00

2 Weeks

Myosin Light Chain 2 (MYL2) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around amino acids 17~21 (A-T-S-N-V) derived from Human Myosin Light Chain 2 Protein.
EGFR Rabbit Polyclonal Antibody
TA312545

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
Caveolin 1 (CAV1) Goat Polyclonal Antibody
AB0055-200

USD 355.00

In Stock

Goat Polyclonal Anti-CAV1 Antibody

Applications IF, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli.
PAK2 Rabbit Polyclonal Antibody
TA306346

USD 570.00

In Stock

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2.
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA308917

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)