MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MYF5 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide (AHKAELQGSDEDEH) of human MYF5 |
Rabbit Polyclonal Anti-MYF5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the N terminal of human MYF5. Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK |
Rabbit polyclonal MYF5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from inetrnal of human MYF5. |
MYF5 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
MYF5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 6-36aa) of human Myogenic factor 5 (MYF5) |
Goat Polyclonal Antibody against MYF5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PECNSPVWSRKSST, from the internal region of the protein sequence according to NP_005584.1. |
Rabbit Polyclonal anti-MYF5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the C terminal of human MYF5. Synthetic peptide located within the following region: LSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRL |
Rabbit Polyclonal anti-Myf5 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Myf5 antibody is: synthetic peptide directed towards the middle region of Rat Myf5. Synthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN |
MYF5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human MYF5 (NP_005584.2). |