Antibodies

View as table Download

MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MYF5 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-MYF5 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide (AHKAELQGSDEDEH) of human MYF5

Rabbit Polyclonal Anti-MYF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the N terminal of human MYF5. Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK

Rabbit polyclonal MYF5 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from inetrnal of human MYF5.

MYF5 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

MYF5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 6-36aa) of human Myogenic factor 5 (MYF5)

Goat Polyclonal Antibody against MYF5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PECNSPVWSRKSST, from the internal region of the protein sequence according to NP_005584.1.

Rabbit Polyclonal anti-MYF5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the C terminal of human MYF5. Synthetic peptide located within the following region: LSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRL

Rabbit Polyclonal anti-Myf5 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Myf5 antibody is: synthetic peptide directed towards the middle region of Rat Myf5. Synthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN

MYF5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human MYF5 (NP_005584.2).