SOCS3 mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOCS3 mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AKT1 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-STAT3 mouse monoclonal antibody, clone OTI21E7 (formerly 21E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AKT3 mouse monoclonal antibody, clone OTI9B2 (formerly 9B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AKT1 mouse monoclonal antibody, clone OTI4D6 (formerly 4D6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
AKT1 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | FC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal RELA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA. |
JNK1 (MAPK8) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against GLUT1
Applications | ChIP, FC, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Anti-STAT3 mouse monoclonal antibody, clone OTI21E7 (formerly 21E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".