Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 435 results

Page 1 of 29

(reset)

BIRC5 Rabbit Polyclonal Antibody

TA301775

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker

Applications	ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse, Rat, Feline, Dog
Conjugation	Unconjugated
Immunogen	Full-length recombinant human survivin.

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

HMG1 (HMGB1) Rabbit Polyclonal Antibody

TA301448

USD 630.00

2 Weeks

Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker

Applications	ELISA, FC, ICC/IF, IHC, Simple Western, WB
Reactivities	Human, Mouse, Dog, Bovine, Hamster, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429]

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PCNA Rabbit Polyclonal Antibody

TA590137

USD 482.00

In Stock

Rabbit Polyclonal PCNA Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

HDAC2 Rabbit Polyclonal Antibody

TA590734

USD 482.00

In Stock

Rabbit Polyclonal HDAC2 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

APE1 (APEX1) Rabbit Polyclonal Antibody

TA301441

USD 550.00

In Stock

Rabbit Polyclonal Antibody against APE1

Applications	Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Hsc70 (HSPA8) Rabbit Polyclonal Antibody

TA346659

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications	IHC, WB
Reactivities	Rat, Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Grp75 (HSPA9) Rabbit Polyclonal Antibody

TA329128

USD 539.00

5 Days

Rabbit Polyclonal anti-HSPA9 antibody

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody

TA311853

USD 380.00

2 Weeks

Rabbit polyclonal anti-Cyclin E1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Cyclin E1.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hsc70 (HSPA8) Goat Polyclonal Antibody

TA302666

USD 520.00

5 Days

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications	IF, IHC, WB
Reactivities	Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

1 / 3

2 / 3

3 / 3

Previous Next

CD168 (HMMR) Rabbit Polyclonal Antibody

TA319659

USD 570.00

2 Weeks

Rabbit Polyclonal RHAMM Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	RHAMM antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human RHAMM.

1 / 3

2 / 3

3 / 3

Previous Next

PARP1 Rabbit Polyclonal Antibody

TA321381

USD 380.00

4 Weeks

Anti-PARP1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 227-240 amino acids of Human poly (ADP-ribose) polymerase 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Paxillin (PXN) Rabbit Polyclonal Antibody

TA321540

USD 380.00

In Stock

Anti-PXN Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human paxillin

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOCS1 Rabbit Polyclonal Antibody

TA321592

USD 380.00

4 Weeks

Anti-SOCS1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 200-211 amino acids of Human suppressor of cytokine signaling 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SOCS1 Rabbit Polyclonal Antibody

TA321593

USD 380.00

In Stock

Anti-SOCS1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAK1 Rabbit Polyclonal Antibody

TA323823

USD 380.00

In Stock

Anti-PAK1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TA323823 is a possible alternative to TA323824.

1 - 15 of 435 results

Page 1 of 29