Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal Anti-CACNB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE |
Active filters
Applications
- WB
Clonalities
- Polyclonal
Families
- Ion Channels: Other
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)