Germany
Japan
United Kingdom
China
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Antibodies
View as table Download
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit polyclonal KLF4 Antibody
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 481-504 amino acids from human KLF4. |
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Reactivities
- Rat
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Embryonic stem cells
Filter by
Category
Target Symbol
- SMAD3 (15)
- SMAD2 (12)
- C-MYC (8)
- HNF1 BETA (7)
- OCT4 (6)
- FGF4 (5)
- GATA4 (5)
- CDX2 (4)
- FOXA2 (4)
- NEUROD1 (4)
- SOX9 (4)
- BDNF (3)
- CD117 (3)
- DNMT3B (3)
- KLF4 (3)
- SOX2 (3)
- BMP2 (2)
- BMP4 (2)
- BMP6 (2)
- CD44 (2)
- CD9 (2)
- PAX3 (2)
- PDX1 (2)
- BMP5 (1)
- BMP7 (1)
- CCN4 (1)
- CD34 (1)
- EGF (1)
- GATA6 (1)
- GDF3 (1)
- IGFBP1 (1)
- IGFBP2 (1)
- NANOG (1)
- PAX4 (1)
- PDGFC (1)
- PTF1A (1)
- TAT (1)
Antibody Hosts
Conjugates
Modifications
Pathways
- Pathways in cancer (48)
- TGF-beta signaling pathway (43)
- Cell cycle (35)
- Colorectal cancer (35)
- Wnt signaling pathway (35)
- Pancreatic cancer (28)
- Adherens junction (27)
- Chronic myeloid leukemia (23)
- Maturity onset diabetes of the young (18)
- MAPK signaling pathway (17)
- Acute myeloid leukemia (13)
- Hematopoietic cell lineage (10)
- Bladder cancer (9)
- Endometrial cancer (9)
- ErbB signaling pathway (9)
- Cytokine-cytokine receptor interaction (8)
- Hedgehog signaling pathway (8)
- Jak-STAT signaling pathway (8)
- Small cell lung cancer (8)
- Thyroid cancer (8)
- Melanoma (7)
- Regulation of actin cytoskeleton (7)
- Endocytosis (6)
- Melanogenesis (5)
- Basal cell carcinoma (4)
- Cysteine and methionine metabolism (4)
- Metabolic pathways (4)
- Huntington's disease (3)
- Neurotrophin signaling pathway (3)
- ECM-receptor interaction (2)
- Focal adhesion (2)
- Gap junction (2)
- Prostate cancer (2)
- Type II diabetes mellitus (2)
- Cell adhesion molecules (CAMs) (1)
- Glioma (1)
- Non-small cell lung cancer (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Tyrosine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)