Rabbit Polyclonal HIF-2 alpha Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal Calreticulin Antibody
| Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Rabbit Polyclonal Antibody against APE1
| Applications | Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal STAT1 alpha Antibody
| Applications | ELISA, ICC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STAT1 alpha antibody was raised against a peptide corresponding to 38 amino acids near the carboxy terminus of human STAT1 alpha. The sequences differ from the murine corresponding sequences by four amino acids. The immunogen is located within the last 50 amino acids of STAT1 alpha. |
Rabbit Polyclonal Anti-hKV11.1 (HERG)
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG). Intracellular, C-terminus. |
HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide mapping at the N-terminus of HIF-1α of Human origin, different from the related Rat and Mouse sequences by two sequences. |
Germany
Japan
United Kingdom
China
