Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Calreticulin Antibody
| Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Interferon beta (IFNB1) rabbit polyclonal antibody
| Applications | ELISA, FN, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Anti-Sema3f Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
Rabbit Polyclonal LOX propeptide Antibody
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human LOX propeptide (within residues 118-168). [Swiss-Prot# P28300] |
Properdin (CFP) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antigen has been isolated from pooled Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Lactoferrin (LTF) goat polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Exocrine organs produce various secretions, each with its characteristic function. Proteins found in secretions may be divided into two groups: those specific for the particular secretion, and plasma proteins independent of the type of exocrine cells. Lactoferrin belongs to the first group. It is an iron containing protein with a molecular weight of 75,000 and it is antigenically different from transferrin. Lactoferrin has a slight anti-microbial action. Originally identified in milk, its presence has also been demonstrated in other secretions as saliva, semen and tears. The immunogen has been isolated from human milk. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Uroguanylin (GUCA2B) (1-8) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human Uroguanylin (aa 1-8) circulating form (FKTLRTIA) |
Rabbit anti-GDF15 Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GDF15 |
Plasminogen (PLG) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IP
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Secreted Protein
Filter by
Target Symbol
Antibody Hosts
Isotypes
Assay Types
Pathways
- Complement and coagulation cascades (4)
- Cytokine-cytokine receptor interaction (4)
- Jak-STAT signaling pathway (3)
- Natural killer cell mediated cytotoxicity (3)
- Systemic lupus erythematosus (3)
- Cytosolic DNA-sensing pathway (2)
- Endocytosis (2)
- Hematopoietic cell lineage (2)
- Melanogenesis (2)
- Neuroactive ligand-receptor interaction (2)
- RIG-I-like receptor signaling pathway (2)
- TGF-beta signaling pathway (2)
- Toll-like receptor signaling pathway (2)
- Acute myeloid leukemia (1)
- Allograft rejection (1)
- Antigen processing and presentation (1)
- Axon guidance (1)
- Basal cell carcinoma (1)
- Calcium signaling pathway (1)
- Dilated cardiomyopathy (1)
- Gap junction (1)
- GnRH signaling pathway (1)
- Graft-versus-host disease (1)
- Hedgehog signaling pathway (1)
- Long-term depression (1)
- Pathways in cancer (1)
- Proteasome (1)
- Regulation of autophagy (1)
- T cell receptor signaling pathway (1)
- Taste transduction (1)
- Type I diabetes mellitus (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)