Semaphorin 3F (SEMA3F) Rabbit Polyclonal Antibody

CAT#: TA342215

Rabbit polyclonal Anti-Sema3f Antibody

Product Images

WB Suggested Anti-Sema3f Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

• 

  WB Suggested Anti-SEMA3F Antibody ; Positive Control: Lane 1: No transfection, Lane, 2: Cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane 3: AP-alone, Lane 4: The cell media from cells transfected with AP-Sem

• 

  Sample Type :; Untransfected HEK293 and Sema3F-AP transfected HEK293 Primary Antibody Dilution :; 1:1000 Secondary Antibody :; Anti rabbit-Alexa Fluor 488 Secondary Antibody Dilution :; 1:500 Color/Signal Descriptions :; Gene Name :; SEMA3F

• 

  Application: IP; Species+tissue/cell type:1.5mL conditioned media from HEK293F cells transfected with 1: Sema 3F_AP, 2: Sema3C_FLAG, 3: UntransfectedAmount of IP Antibody: Amount of IP Antibody: 5ug; Primary antibody dilution: 1:1000; Secondary antibody:

Specifications

Product Data

• Applications: IHC, IP, WB
• Recommended Dilution: IP, IHC, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: semaphorin 3F
• Database Link:
  NP_004177
  Entrez Gene 20350 MouseEntrez Gene 6405 Human
  UniProt ID Q13275
• Background: The function remains unknown.
• Synonyms: SEMA-IV; SEMA4; SEMAK
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 91%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Axon guidance