Rabbit Polyclonal SEMA3B Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200). |
DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I. |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human WNT3 |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Apolipoprotein H (APOH) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IHC |
| Reactivities | Canine, Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified beta2-Glycoprotein-I (beta2GP-I) from human plasma. This protein is also known as apolipoprotein-H. |
CRISP2 (81-93) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to internal sequence amino acids 81-93 of Human CRISP2 (NP_003287.1). |
IL12A goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Human, Porcine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from human IL12A / p35 |
GABA B Receptor 1 (GABBR1) (947-961) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Bovine, Bat, Canine, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the C-terminus of human GABBR1 |
Germany
Japan
United Kingdom
China
