Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 991 results

Page 1 of 67

(reset)

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

CF801621

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

TA801621

USD 447.00

In Stock

LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1C7]

TA801621S

USD 200.00

2 Days

LGALS3 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Eotaxin 3 (CCL26) Rabbit Polyclonal Antibody

TA321741

USD 380.00

2 Weeks

Anti-CCL26 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human chemokine (C-C motif) ligand 26

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SMOC2 Rabbit Polyclonal Antibody

TA351730

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-SMOC2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human SMOC2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ISG15 Rabbit Polyclonal Antibody

TA342596

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ISG15 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Prealbumin (TTR) Rabbit Polyclonal Antibody

TA321119

USD 380.00

4 Weeks

Anti-TTR Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CD8A Rabbit Monoclonal Antibody [Clone ID: OTIR3D5]

TA592695

USD 379.00

2 Weeks

CD8 Rabbit monoclonal antibody,clone OTIR3D5

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

CCN2 Rabbit Polyclonal Antibody

TA323092

USD 380.00

2 Weeks

Anti-CTGF Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 148-159 amino acids of Human Connective tissue growth factor

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IL1RAP Rabbit Polyclonal Antibody

TA324046

USD 380.00

2 Weeks

Anti-IL1RAP Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IL18 Rabbit Polyclonal Antibody

TA324190

USD 380.00

2 Weeks

Anti-IL18 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TA324190 is a possible alternative to TA324189.

PON1 Rabbit Polyclonal Antibody

TA590020

USD 482.00

In Stock

Rabbit Polyclonal PON1 Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Dog, Rat
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

alpha 1 Antichymotrypsin (SERPINA3) Rabbit Polyclonal Antibody

TA323307

USD 380.00

4 Weeks

Anti-AACT Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antichymotrypsin

1 / 3

2 / 3

3 / 3

Previous Next

PLAUR Rabbit Polyclonal Antibody

TA323492

USD 380.00

2 Weeks

Anti-PLAUR Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 23-305 amino acids of human plasminogen activator, urokinase receptor

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

NGF Rabbit Polyclonal Antibody

TA349414

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NGF Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human NGF

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 15 of 991 results

Page 1 of 67