Antibodies

View as table Download

Rabbit Polyclonal DUOX2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8]

Rabbit Polyclonal SEMA3B Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).

DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Canine, Human, Rabbit
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I.

TLR7 (900-950) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Canine, Equine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from a portion of amino acids 900-950 of Human TLR7

XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1.

Rabbit Polyclonal GPR83 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250 of human GPR83 was used as the immunogen for this antibody.

Rabbit Polyclonal LIMPII/lpg85 Antibody

Applications ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114]

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.

Rabbit Polyclonal GRAIL/RNF128 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1.

Calnexin (CANX) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Canine, Bovine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Conjugation Unconjugated
Immunogen CANX antibody was raised against synthetic peptide derived from sequence near the amino-terminus of canine Calnexin, conjugated to KLH

Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Rabbit Polyclonal CRHR2/CRF2 Antibody

Applications ICC/IF, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken
Conjugation Unconjugated
Immunogen A portion of amino acids 75-125 of human CRHR2 was used as the immunogen.

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Canine
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Claudin 1 (CLDN1) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen CLDN1 antibody was raised against a synthetic peptide derived from the C-terminus of human Claudin-1

Rabbit Polyclonal AIF Antibody

Applications IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
Immunogen (aa 151-170); human