Germany
Japan
United Kingdom
China
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Antibodies
View as table Download
Anti-YWHAB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 72-87 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDKN2A Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A. |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Isotypes
- IgG
Pathways
- Cell cycle
Filter by
Target Symbol
- SMAD3 (16)
- CDC25A (15)
- HDAC2 (14)
- P53 (13)
- SMAD2 (13)
- CYCLIN B1 (12)
- GSK3 BETA (12)
- 14-3-3 ZETA (11)
- HDAC1 (11)
- C ABL (10)
- C-MYC (10)
- CHK2 (10)
- RB (10)
- CDK2 (9)
- CHK1 (8)
- 14-3-3 BETA (7)
- CYCLIN A1 (7)
- CYCLIN D1 (7)
- CYCLIN D3 (7)
- P27 KIP 1 (7)
- PCNA (7)
- APC1 (6)
- CDK1 (6)
- P18 INK4C (6)
- SMAD4 (6)
- 14-3-3 EPSILON (5)
- 14-3-3 THETA (5)
- CDC25B (5)
- MCM5 (5)
- MDM2 (5)
- SMC1 (5)
- TGF BETA 1 (5)
- TGF BETA 2 (5)
- APC6 (4)
- BUB3 (4)
- CDC20 (4)
- CYCLIN A2 (4)
- CYCLIN E1 (4)
- CYCLIN H (4)
- E2F2 (4)
- KAT3A / CBP (4)
- MCM2 (4)
- MCM3 (4)
- P15 INK4B (4)
- 14 3 3 GAMMA (3)
- ANAPC13 (3)
- APC10 (3)
- ATR (3)
- CDC23 (3)
- CDC27 (3)
- CDK6 (3)
- CDK7 (3)
- CULLIN 1 (3)
- CYCLIN D2 (3)
- DNA PKCS (3)
- E2F1 (3)
- E2F4 (3)
- EP300 (3)
- GADD45G (3)
- MCM6 (3)
- MCM7 (3)
- MPS1 (3)
- P16INK4A (3)
- P21 (3)
- SKP1 (3)
- APC4 (2)
- APC5 (2)
- ATM (2)
- BUB1 (2)
- DBF4 (2)
- DP1 (2)
- E2F3 (2)
- GADD45B (2)
- MAD2 (2)
- ORC2 (2)
- PKMYT1 (2)
- PLK1 (2)
- RB2 P130 (2)
- TGF BETA 3 (2)
- WEE1 (2)
- 14 3 3 ETA (1)
- 14-3-3 SIGMA (1)
- APC11 (1)
- APC2 (1)
- APC7 (1)
- BUBR1 (1)
- CDC2 (1)
- CDC25C (1)
- CDC26 (1)
- CDC45L (1)
- CDC6 (1)
- CDC7 (1)
- CYCLIN E2 (1)
- DP2 (1)
- E2F5 (1)
- GADD45A (1)
- MAD1 (1)
- MCM4 (1)
- P107 (1)
- P19 INK4D (1)
Applications
Clonalities
Conjugates
Modifications
Assay Types
Families
- Druggable Genome (410)
- Transcription Factors (171)
- Stem cell - Pluripotency (142)
- Protein Kinase (83)
- Stem cell relevant signaling - JAK/STAT signaling pathway (46)
- Embryonic stem cells (39)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (39)
- ES Cell Differentiation/IPS (34)
- Cancer stem cells (29)
- Stem cell relevant signaling - DSL/Notch pathway (22)
- Phosphatase (21)
- Stem cell relevant signaling - Wnt Signaling pathway (17)
- Secreted Protein (13)
- Adult stem cells (11)
- Induced pluripotent stem cells (10)
- Transmembrane (7)
- Protease (1)