Antibodies

Jump to Filters
View as table Download
LOX Rabbit Polyclonal Antibody
TA337077

USD 550.00

2 Weeks

Rabbit Polyclonal LOX Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen Within the range of amino acids 305-338 of human LOX protein were used as the immunogen.
Calreticulin (CALR) Rabbit Polyclonal Antibody
TA336667

USD 550.00

5 Days

Rabbit Polyclonal Calreticulin Antibody

Applications Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Hamster, Primate
Conjugation Unconjugated
Immunogen A fusion protein to mouse Calreticulin [UniProt# P14211]
AGR2 Rabbit Polyclonal Antibody
TA337169

USD 550.00

5 Days

Rabbit Polyclonal AG-2 Antibody

Applications ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against synthetic peptides corresponding to amino acids 55-72 of human AGR2.
Semaphorin 3F (SEMA3F) Rabbit Polyclonal Antibody
TA342215

USD 539.00

2 Weeks

Rabbit polyclonal Anti-Sema3f Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA332753

USD 365.00

3 Weeks

Rabbit anti-GNAS Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNAS
CD71 (TFRC) Rabbit Polyclonal Antibody
TA332972

USD 365.00

3 Weeks

Rabbit anti-TFRC Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFRC