Antibodies

Jump to Filters
View as table Download
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA312629

USD 380.00

In Stock

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.
Caspase 8 (CASP8) Rabbit Polyclonal Antibody
TA324849

USD 580.00

2 Weeks

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.
CD10 (MME) Rabbit Polyclonal Antibody
TA590055

USD 482.00

In Stock

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Caspase-7 (CASP7) Rabbit Polyclonal Antibody
TA590426

USD 482.00

In Stock

Rabbit Polyclonal Caspase 7 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
CD10 (MME) Rabbit Polyclonal Antibody
TA321228

USD 380.00

In Stock

Anti-MME Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase
ADAM17 Rabbit Polyclonal Antibody
TA321563

USD 380.00

In Stock

Anti-ADAM17 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Caspase-7 (CASP7) Rabbit Polyclonal Antibody
TA323199

USD 380.00

In Stock

Anti-CASP7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 207-303 amino acids of human caspase 7, apoptosis-related cysteine peptidase
Calpain 1 (CAPN1) Rabbit Polyclonal Antibody
TA324116

USD 380.00

In Stock

Anti-CAPN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit
BACE1 Rabbit Polyclonal Antibody
TA341892

USD 539.00

5 Days

Rabbit Polyclonal Anti-BACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Rabbit Polyclonal Antibody
TA350583

USD 380.00

In Stock

Rabbit Polyclonal Anti-UQCRC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC1
UQCRC2 Rabbit Polyclonal Antibody
TA350584

USD 380.00

In Stock

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC2
Caspase 3 (CASP3) Rabbit Polyclonal Antibody
TA322764

USD 380.00

4 Weeks

Anti-CASP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase
IDE Rabbit Polyclonal Antibody
TA323993

USD 380.00

4 Weeks

Anti-IDE Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human insulin-degrading enzyme
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 570.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA321309

USD 380.00

In Stock

Anti-CASP9 (active) Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase