Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338] |
Rabbit Polyclonal Anti-CBS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rabbit, Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
USD 580.00
2 Weeks
S adenosylhomocysteine hydrolase (AHCY) (N-term) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 86-118 amino acids from the N-terminal region of human AHCY |
Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088) |
Germany
Japan
United Kingdom
China
