Primary Antibodies

View as table Download

Rabbit Polyclonal CUL4B Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal KEAP1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit anti-BRCA1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).

Rabbit Polyclonal anti-ERCC8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG

Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531)

Rabbit polyclonal Parkin Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin.

Rabbit Polyclonal UBE2S Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501).

Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1).

Rabbit Polyclonal XIAP Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP.

Anti-SOCS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 200-211 amino acids of Human suppressor of cytokine signaling 1

Anti-SOCS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1

Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)

Applications IF, IHC, IP, WB
Reactivities Human (Predicted: Xenopus, Pig, Chicken, Bovine, Rhesus Monkey, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036)

Rabbit polyclonal TTK (Ab-676) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V).

Anti-CDC20 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog