Germany
Japan
United Kingdom
China
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Rat, Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Primary Antibodies
View as table Download
Rabbit polyclonal GRIN2B(Ab-1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the N-terminus of NMDAR2B of human origin |
Rabbit Polyclonal anti-GRIN2A Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIN2A |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-GRIN2B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1413-1425 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2B |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B (Tyr1336) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1336 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR2B (Tyr1474) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1474 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Human
Families
- Ion Channels: Glutamate Receptors
Pathways
- Systemic lupus erythematosus