Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal ATM Antibody
| Applications | ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315] |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit Polyclonal antibody to PIG3 (tumor protein p53 inducible protein 3)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 332 of PIG3 (Uniprot ID#Q53FA7) |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit Polyclonal CDKN2A Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Active filters
Category
- Antibodies
Reactivities
- Human
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- p53 signaling pathway
Filter by
Target Symbol
- P53 (51)
- CASPASE 3 (23)
- CHK1 (23)
- CASPASE 9 (22)
- CHK2 (20)
- CYCLIN B1 (19)
- CDK1 (18)
- BAX (17)
- MDM2 (13)
- P16INK4A (13)
- CYCLIN D1 (12)
- P73 (12)
- PTEN (12)
- CASPASE 8 (11)
- CD95 (11)
- PAI1 (11)
- TUBERIN (10)
- CDK2 (9)
- CYCLIN E1 (9)
- IGF1 (9)
- SKP2 (9)
- APAF1 (8)
- ATM (8)
- BCL2 BINDING COMPONENT 3 (8)
- DR5 (8)
- MASPIN (8)
- CYCLIN D3 (7)
- CYCLIN E2 (7)
- CYCLIN G (7)
- P21 (7)
- SIAH1 (7)
- CDK6 (6)
- CYTOCHROME C (6)
- THROMBOSPONDIN 1 (6)
- 14-3-3 SIGMA (5)
- CYCLIN B2 (5)
- CYCLIN D2 (5)
- RRM2 (5)
- ATR (4)
- BID (4)
- CD82 (4)
- CDC2 (4)
- GADD45A (4)
- IGFBP3 (4)
- PIG3 (4)
- BAI1 (3)
- CDK4 (3)
- CYCLIN B3 (3)
- DDB2 (3)
- EI24 (3)
- GTSE1 (3)
- LRDD (3)
- P53R2 (3)
- PIRH2 (3)
- CYCLIN G2 (2)
- GADD45B (2)
- NOXA (2)
- P53 AIP1 (2)
- PERP (2)
- PPM1D (2)
- MDMX (1)