Primary Antibodies

Jump to Filters
View as table Download
beta Actin (ACTB) Goat Polyclonal Antibody
AB0145-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA890010

USD 348.00

In Stock

Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Mouse, Monkey, Dog, Rat
Conjugation Unconjugated
Immunogen ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB
CD11b (ITGAM) Rabbit Polyclonal Antibody
TA336565

USD 605.00

5 Days

Rabbit Polyclonal Integrin alpha M/CD11b Antibody

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555]
CD31 (PECAM1) Rabbit Polyclonal Antibody
TA313338

USD 380.00

2 Weeks

Rabbit polyclonal PECAM-1 (Ab-713) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA336689

USD 575.00

5 Days

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA345667

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
beta Catenin (CTNNB1) Goat Polyclonal Antibody
AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.
CD31 (PECAM1) (C-term) Rabbit Polyclonal Antibody
AP31323PU-N

USD 535.00

2 Weeks

CD31 (PECAM1) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from Human PECAM-1.
Epitope: C-Terminus.
CD31 (PECAM1) Rabbit Polyclonal Antibody
TA309798

USD 550.00

5 Days

Rabbit Polyclonal CD31/PECAM1 Antibody

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Pecam1 protein (within residues 100-300). [Swiss-Prot P16284]
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA336477

USD 550.00

5 Days

Rabbit Polyclonal beta-Actin Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Amino acids 2-16 (CDDDIAALVIDNGSG) of actin protein were used as the immunogen.
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA321277

USD 380.00

In Stock

Anti-ACTN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA321516

USD 380.00

In Stock

Anti-PRKCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA321517

USD 380.00

In Stock

Anti-PRKCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha
CXCR4 Rabbit Polyclonal Antibody
TA336493

USD 550.00

5 Days

Rabbit Polyclonal CXCR4 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073]
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA349205

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.