Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Recombinant Anti-CD44 (Clone Hermes-1)
| Applications | Bl, ELISA, FC, IF, IHC, IP, Neutralize, WB |
| Reactivities | Human, Mouse, Rat, Goat, Primate, Rabbit, Sheep, Bovine |
| Conjugation | Unconjugated |
Desmin (DES) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Goat, Hamster, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Chicken gizzard muscle Desmin. Desmin was purified from a crude tissue preparation by preparative gel electrophoresis as described in Reference 1. |
Rabbit Polyclonal Anti-PAK6 Antibody (Linker Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Goat, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | PAK6 antibody was raised against synthetic 18 amino acid peptide from Linker domain of human PAK6. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Dog, Horse (100%); Goat, Elephant, Panda, Rabbit (94%); Hamster, Bovine (89%); Mouse, Bat (83%). |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Gibbon, Hamster, Horse (Predicted: Mouse, Rat, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
Recombinant Anti-CD81 (Clone 1D6)
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Chimpanzee, Goat, Sheep |
| Conjugation | Unconjugated |
Biotinylated Rabbit monoclonal to GAPDH
| Applications | ChIP, ICC, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Goat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
