Tnf (NM_012675) Rat Recombinant Protein

CAT#: TP723453

Purified recombinant protein of Rat tumor necrosis factor (TNF superfamily, member 2) (Tnf).


 Product Datasheet for 'TP723453'

  View other "Tnf" proteins (6)

Use code "PROTEIN10" to save 10%

USD 230.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat tumor necrosis factor (TNF superfamily, member 2) (Tnf).
Species Rat
Expression Host E.Coli
Expression cDNA Clone or AA Sequence MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Tag Tag Free
Predicted MW 17.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_036807
Locus ID 24835
Refseq Size 1687
Refseq ORF 705
Synonyms RATTNF; TNF-alpha; Tnfa

Documents

Other Versions

Frequently bought together (1)
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
    • 100 ul

USD 360.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies