Tnf (NM_012675) Rat Recombinant Protein

CAT#: TP723453

Reviews ()
Write a review

Purified recombinant protein of Rat tumor necrosis factor (TNF superfamily, member 2) (Tnf).



  View other "Tnf" proteins (5)

USD 240.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat tumor necrosis factor (TNF superfamily, member 2) (Tnf).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MLRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Tag Tag Free
Predicted MW 17.3 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_036807
Locus ID 24835
Refseq Size 1687
Cytogenetics 20p12
Refseq ORF 705
Synonyms RATTNF; TNF-alpha; Tnfa
Summary acts as a cytokine; binds TNF receptors; plays a role in regulation of cell proliferation, induction of apoptosis, and inflammatory response [RGD, Feb 2006]

Documents

Other Versions

Frequently bought together (1)
Biotinylated Anti-Rat TNF-a Rabbit Polyclonal Antibody
    • 50 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101