TGF beta 2 (TGFB2) (NM_003238) Human Recombinant Protein

CAT#: TP723441

Reviews ()
Write a review

Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 2.


 Product Datasheet for 'TP723441'

  View other "TGFB2" proteins (10)

USD 230.00

USD 399.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 2.
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Tag Tag Free
Predicted MW 25 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. ED50 was found to be < 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_003229
Locus ID 7042
Refseq Size 1695
Cytogenetics 1q41
Refseq ORF 1242
Synonyms G-TSF; LDS4; TGF-beta2
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway

Documents

Other Versions

Other products for "TGFB2"
Frequently bought together (1)
Rabbit polyclonal anti-TGFB2 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101