Tnfsf11 (NM_057149) Rat Recombinant Protein

CAT#: TP723423

Purified recombinant protein of Rat tumor necrosis factor (ligand) superfamily, member 11 (Tnfsf11).


 Product Datasheet for 'TP723423'

 Cited in 1 publication.

  View other "Tnfsf11" proteins (2)

Use code "PROTEIN10" to save 10%

USD 230.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat tumor necrosis factor (ligand) superfamily, member 11 (Tnfsf11).
Species Rat
Expression Host E.Coli
Expression cDNA Clone or AA Sequence PAMMEGSWLDVARRGKPEAQPFAHLTINAADIPSGSHKVSLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPADYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISVQVSNPSLLDPDQDATYFGAFKVQDID
Tag Tag Free
Predicted MW 19.4 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to induce NFkB in RAW264.7 cells in the absence of any cross-linking. The expected ED50 for this effect is 10.0-25.0 ng/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_476490
Locus ID 117516
Refseq Size 957
Refseq ORF 954
Synonyms RANKL; RANKL

Citations (1)

Documents

Other Versions

Other products for "Tnfsf11"
Frequently bought together (1)
Mouse Monoclonal TRANCE/TNFSF11/RANK L Antibody (12A668)
    • 0.1 mg

USD 450.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies