RANKL (TNFSF11) (NM_003701) Human Recombinant Protein

CAT#: TP723421

Reviews ()
Write a review

Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1.



  View other "TNFSF11" proteins (9)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1.
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Tag Tag Free
Predicted MW 20 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to induce NFkB in RAW264.7 cells in the absence of any cross-linking. The expected ED50 for this effect is 10.0-25.0 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_143026
Locus ID 8600
Refseq Size 2226
Cytogenetics 13q14.11
Refseq ORF 951
Synonyms CD254; hRANKL2; ODF; OPGL; OPTB2; RANKL; sOdf; TNLG6B; TRANCE
Summary This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction

Documents

Other Versions

Other products for "TNFSF11"
Frequently bought together (1)
Rabbit Polyclonal sRANK Ligand Antibody
    • 100 ug

USD 430.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101