Cxcl12 (NM_021704) Mouse Recombinant Protein
Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1.
Product images

Specifications
Product Data | |
Description | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1. |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM |
Tag | Tag Free |
Predicted MW | 8.5 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract human monocytes using a concentration range of 50.0-100.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_068350 |
Locus ID | 20315 |
Refseq Size | 1878 |
Cytogenetics | 6 F1 |
Refseq ORF | 270 |
Synonyms | Pbsf; Scyb12; Sdf1; Tlsf; Tpar1 |
Summary | This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP527145 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP723403 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1. |
USD 240.00 |
|
TP723404 | Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2. |
USD 240.00 |
|
TP723407 | Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2. |
USD 240.00 |
|
TP723771 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12 / SDF-1alpha), transcript variant 1 |
USD 325.00 |
|
TP723857 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12 / SDF-1beta), transcript variant 2 |
USD 325.00 |