Cxcl12 (NM_021704) Mouse Recombinant Protein

CAT#: TP723403

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1.

Specifications

Product Data

• Description: Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1.
• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
• Tag: Tag Free
• Predicted MW: 7.9 kDa
• Concentration: lot specific
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human peripheral blood monocytes using a concentration of 50-100 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068350
• Locus ID: 20315
• Refseq Size: 1878
• Cytogenetics: 6 F1
• Refseq ORF: 270
• Synonyms: Pbsf; Scyb12; Sdf1; Tlsf; Tpar1
• Summary: This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]