Cxcl12 (NM_021704) Mouse Recombinant Protein

CAT#: TP723403

Reviews ()
Write a review

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1.



  View other "Cxcl12" proteins (6)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1.
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Tag Tag Free
Predicted MW 7.9 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human peripheral blood monocytes using a concentration of 50-100 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_068350
Locus ID 20315
Refseq Size 1878
Cytogenetics 6 F1
Refseq ORF 270
Synonyms Pbsf; Scyb12; Sdf1; Tlsf; Tpar1
Summary This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Documents

Other Versions

Other products for "Cxcl12"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101