SDF1 (CXCL12) (NM_000609) Human Recombinant Protein

CAT#: TP723402

Reviews ()
Write a review

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2.



  View other "CXCL12" proteins (10)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2.
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Tag Tag Free
Predicted MW 8 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentation of 20-80 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000600
Locus ID 6387
UniProt ID P48061
Cytogenetics 10q11.21
Refseq Size 3560
Refseq ORF 279
Synonyms IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1
Summary This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration

Documents

Other Versions

Other products for "CXCL12"
Frequently bought together (1)
Rabbit Polyclonal CXCL12 Antibody
    • 100 ug

USD 440.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools
HUMAN PROREINS 101