Ccl5 (NM_031116) Rat Recombinant Protein

CAT#: TP723375

Reviews ()
Write a review

Purified recombinant protein of Rat chemokine (C-C motif) ligand 5 (Ccl5).



  View other "Ccl5" proteins (3)

USD 240.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat chemokine (C-C motif) ligand 5 (Ccl5).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Tag Tag Free
Predicted MW 7.9 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Assay#1: Determined by its ability to chemoattract rat peritoneal macrophages using a concentration range of 50.0-100.0 ng/ml. Assay#2: Determined by its ability to chemoattract human blood monocytes using a concentration range of 10.0-100.0 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_112378
Locus ID 81780
Refseq Size 570
Cytogenetics 10q26
Refseq ORF 276
Synonyms Rantes; Scya5
Summary may play a role in cellular response to viral infection in testicular somatic cells [RGD, Feb 2006]

Documents

Other Versions

Other products for "Ccl5"
Frequently bought together (1)
Anti-Rat RANTES Rabbit Polyclonal Antibody
    • 100 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101