Csf1 (NM_023981) Rat Recombinant Protein

CAT#: TP723290

Purified recombinant protein of Rat colony stimulating factor 1 (macrophage) (Csf1).


 Product Datasheet for 'TP723290'

 Cited in 1 publication.

  View other "Csf1" proteins (3)

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat colony stimulating factor 1 (macrophage) (Csf1).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
Tag Tag Free
Predicted MW 18.1 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than or equal to 5.0 ng/ml, corresponding to a specific activity of >2 x 10^5 units/mg.
Cell culture factor (PMID: 30022569)
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_076471
Locus ID 78965
Refseq Size 3975
Refseq ORF 1716

Citations (1)

Documents

Other Versions

Other products for "Csf1"
Frequently bought together (1)
Rabbit Polyclonal MCSF Antibody
    • 100 ug

USD 409.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones