Csf1 (NM_023981) Rat Recombinant Protein

CAT#: TP723290

Reviews ()
Write a review

Purified recombinant protein of Rat colony stimulating factor 1 (macrophage) (Csf1).



  View other "Csf1" proteins (4)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat colony stimulating factor 1 (macrophage) (Csf1).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
Tag Tag Free
Predicted MW 18.1 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than or equal to 5.0 ng/ml, corresponding to a specific activity of >2 x 10^5 units/mg.
Cell culture factor (PMID: 30022569)
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_076471
Locus ID 78965
Refseq Size 3975
Cytogenetics 2q34
Refseq ORF 1698
Summary plays a role in macrophage formation; involved in osteoclastogenesis and endochondral ossification [RGD, Feb 2006]

Citations (1)

Documents

Other Versions

Other products for "Csf1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101