IL8 (CXCL8) (NM_000584) Human Recombinant Protein
Purified recombinant protein of Human interleukin 8 (IL8).
Specifications
Product Data | |
Description | Purified recombinant protein of Human interleukin 8 (IL8). |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Tag | Tag Free |
Predicted MW | 8.9 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 25.0-150.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000575 |
Locus ID | 3576 |
Refseq Size | 1666 |
Cytogenetics | 4q13.3 |
Refseq ORF | 297 |
Synonyms | GCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1 |
Summary | The protein encoded by this gene is a member of the CXC chemokine family and is a major mediator of the inflammatory response. The encoded protein is commonly referred to as interleukin-8 (IL-8). IL-8 is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis, a common respiratory tract disease caused by the respiratory syncytial virus (RSV). The overproduction of this proinflammatory protein is thought to cause the lung inflammation associated with csytic fibrosis. This proinflammatory protein is also suspected of playing a role in coronary artery disease and endothelial dysfunction. This protein is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes (eg, sepsis). This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q. [provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Bladder cancer, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway, Pathways in cancer, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400198 | CXCL8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LY400198 | Transient overexpression lysate of interleukin 8 (IL8) |
USD 360.00 |
|
PH302075 | IL8 MS Standard C13 and N15-labeled recombinant protein (NP_000575) |
USD 2,260.00 |
|
TP302075 | Recombinant protein of human interleukin 8 (IL8) |
USD 748.00 |
|
TP720027 | Recombinant protein of human interleukin 8 (IL8) |
USD 300.00 |
|
TP720029 | Recombinant protein of human interleukin 8 (IL8) |
USD 300.00 |
|
TP721122 | Purified recombinant protein of Human interleukin 8 (IL8) |
USD 300.00 |
|
TP723246 | Purified recombinant protein of Human interleukin 8 (IL8). |
USD 240.00 |
|
TP723733 | Purified recombinant protein of Human interleukin 8 (IL8) |
USD 245.00 |
USD 379.00