Il17a (NM_010552) Mouse Recombinant Protein

CAT#: TP723198

Purified recombinant protein of Mouse interleukin 17A (Il17a).


 Product Datasheet for 'TP723198'

Need it in bulk or customized?
Get a free quote

USD 139.00

USD 199.00


Availability*
5 Days

Size
    • 25 ug

Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse interleukin 17A (Il17a).
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Tag Tag Free
Predicted MW 30 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Measured by its ability to induce IL-6 production by NIH 3T3 cells.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_034682
Locus ID 16171
Refseq Size 1171
Refseq ORF 474
Synonyms Ctla-8; Ctla8; IL-17; IL-17A; Il17
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents