Il17a (NM_010552) Mouse Recombinant Protein

CAT#: TP723198

Reviews ()
Write a review

Purified recombinant protein of Mouse interleukin 17A (Il17a).


Product Datasheet for 'TP723198'


  View other "Il17a" proteins (3)

USD 240.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse interleukin 17A (Il17a).
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Tag Tag Free
Predicted MW 30 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Measured by its ability to induce IL-6 production by NIH 3T3 cells.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Reference Data
RefSeq NP_034682
Locus ID 16171
Refseq Size 1171
Cytogenetics 1 A4
Refseq ORF 477
Synonyms Ctla-8; Ctla8; IL-17; IL-17A; Il17
Summary This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Sep 2015]

Documents

Other Versions

Other products for "Il17a"
Frequently bought together (1)
Rat monoclonal Mouse IL-17A antibody
    • 100 ug

USD 530.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101