Cxcl2 (NM_053647) Rat Recombinant Protein

CAT#: TP723150

Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 2 (Cxcl2).


 Product Datasheet for 'TP723150'

  View other "Cxcl2" proteins (2)

USD 230.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 2 (Cxcl2).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
Tag Tag Free
Predicted MW 7.9 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_446099
Locus ID 114105
Refseq Size 1101
Refseq ORF 300
Synonyms Mip-2; Scyb2

Documents

Other Versions

Other products for "Cxcl2"
Frequently bought together (1)
Anti-Human GRO-ß Rabbit Polyclonal Antibody
    • 100 ug

USD 275.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones