Csf2 (NM_009969) Mouse Recombinant Protein

CAT#: TP723143

Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2).


 Product Datasheet for 'TP723143'

  View other "Csf2" proteins (9)

USD 230.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2).
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Tag Tag Free
Predicted MW 14.2 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_034099
Locus ID 12981
Refseq Size 1033
Refseq ORF 423
Synonyms Csfgm; Gm-CSf; GMCSF; MGI-IGM; CSF

Documents

Other Versions

Other products for "Csf2"
Frequently bought together (1)
CSF2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
    • 100 ul

USD 360.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones