FGF4 (NM_002007) Human Recombinant Protein
Purified recombinant protein of Human fibroblast growth factor 4 (FGF4).
Specifications
Product Data | |
Description | Purified recombinant protein of Human fibroblast growth factor 4 (FGF4). |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence | GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL |
Tag | Tag Free |
Predicted MW | 19.7 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is = 10 ng/ml, corresponding to a specific activity of = 1 x 10^5 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001998 |
Locus ID | 2249 |
Refseq Size | 1219 |
Cytogenetics | 11q13.3 |
Refseq ORF | 618 |
Synonyms | FGF-4; HBGF-4; HST; HST-1; HSTF-1; HSTF1; K-FGF; KFGF |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419590 | FGF4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LY419590 | Transient overexpression lysate of fibroblast growth factor 4 (FGF4) |
USD 360.00 |
|
TP723876 | Purified recombinant protein of Human fibroblast growth factor 4 (FGF4) |
USD 220.00 |
|
TP750009 | Recombinant protein of human Fibroblast Growth Factor-4 (FGF4) produced in E. coli. |
USD 425.00 |