NKIRAS1 (NM_020345) Human Mass Spec Standard
CAT#: PH304248
NKIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_065078)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204248 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC204248 protein sequence
Red=Cloning site Green=Tags(s) MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVE LPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAK SEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_065078 |
RefSeq Size | 2013 |
RefSeq ORF | 576 |
Synonyms | kappaB-Ras1; KBRAS1 |
Locus ID | 28512 |
UniProt ID | Q9NYS0 |
Cytogenetics | 3p24.2 |
Summary | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412541 | NKIRAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412541 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 1 (NKIRAS1) |
USD 436.00 |
|
TP304248 | Recombinant protein of human NFKB inhibitor interacting Ras-like 1 (NKIRAS1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review