Ngf (NM_001277055) Rat Tagged ORF Clone

CAT#: RR216118

Ngf (myc-DDK-tagged) - Rat nerve growth factor (beta polypeptide) (Ngf)

Product Images

Circular map for RR216118

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Ngf
• Synonyms: beta-NGF; Ngfb
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR216118 representing NM_001277055
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCATGTTGTTCTACACTCTGATCACAGCGTTTTTGATCGGCGTACAGGCAGAACCGTACACAGATA
  GCAATGTCCCAGAGGGAGACTCTGTCCCTGAAGCCCACTGGACTAAACTTCAGCATTCCCTTGACACAGC
  CCTCCGCAGAGCCCGCAGTGCCCCTGCTGAACCAATAGCTGCCCGTGTGACAGGGCAGACCCGCAACATC
  ACTGTGGACCCCAAACTGTTTAAGAAACGGAGACTCCGTTCACCCCGCGTGCTGTTTAGCACCCAGCCTC
  CACCCACCTCTTCGGACACTCTGGATTTAGACTTCCAGGCCCATGGTACAATCTCCTTCAACAGGACTCA
  CAGGAGCAAGCGCTCATCCACCCACCCAGTCTTCCACATGGGGGAGTTTTCAGTGTGTGACAGTGTCAGT
  GTGTGGGTTGGAGATAAGACCACAGCCACGGACATCAAGGGCAAGGAGGTGACAGTGCTGGGCGAGGTGA
  ACATTAACAACAGTGTATTCAAACAGTATTTTTTTGAGACCAAGTGCCGAGCCCCGAATCCTGTAGAGAG
  TGGATGCCGGGGCATTGACTCCAAGCACTGGAACTCATACTGCACCACGACTCACACCTTTGTCAAGGCG
  TTGACAACAGACGACAAACAGGCTGCCTGGAGGTTCATCAGGATAGATACAGCCTGCGTGTGTGTGCTCA
  GCAGGAAGGCTGCAAGAAGAGGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR216118 representing NM_001277055
  Red=Cloning site Green=Tags(s)
  
  MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPAEPIAARVTGQTRNI
  TVDPKLFKKRRLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSKRSSTHPVFHMGEFSVCDSVS
  VWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKA
  LTTDDKQAAWRFIRIDTACVCVLSRKAARRG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001277055
• ORF Size: 723 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001277055.1, NP_001263984.1
• RefSeq Size: 1075 bp
• RefSeq ORF: 726 bp
• Locus ID: 310738
• UniProt ID: P25427
• Cytogenetics: 2q34
• MW: 27 kDa
• Gene Summary: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (By similarity). The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro) (By similarity). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI (By similarity). Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form (By similarity).[UniProtKB/Swiss-Prot Function]