Eif4ebp1 (NM_053857) Rat Tagged ORF Clone

CAT#: RR213165

Eif4ebp1 (Myc-DDK-tagged ORF) - Rat eukaryotic translation initiation factor 4E binding protein 1 (Eif4ebp1), (10 ug)

Change vector?

  • TrueORF®

USD 402


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Eif4ebp1 (NM_053857) Rat Tagged ORF Clone
Symbol Eif4ebp1
Synonyms PHAS-I; PHAS-I
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR213165 representing NM_053857
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCGGGCAGCAGTTGCAGCCAGACTCCCAGCCGGGCTATCCCCACTCGCCGCGTAGCCCTCGGCG
ACGGCGTGCAGCTCCCGCCCGGGGACTACAGCACCACCCCCGGCGGCACGCTCTTCAGCACCACCCCGGG
AGGAACCAGAATCATCTATGACCGGAAATTCCTGATGGAGTGTCGGAACTCGCCTGTGGCCAAAACACCC
CCAAAGGACCTGCCAACCATTCCAGGGGTCACTAGCCCTACCAGCGATGAGCCTCCCATGCAGGCCAGCC
AGAGCCATCTGCACAGCAGCCCGGAAGATAAGCGGGCAGGTGGTGAAGAGTCACAGTTTGAGATGGACAT
TT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR213165 representing NM_053857
Red=Cloning site Green=Tags(s)

MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTP
PKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_053857
ORF Size 352 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_053857.1, NM_053857.2, NP_446309
RefSeq Size 862
RefSeq ORF 354
Locus ID 116636
Cytogenetics 16q12.3
MW 12.9 kDa
Gene Summary forms a complex with eukaryotic initiation factor-4E (eIF-4E) and is anintracellular target for insulin and growth factors [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations