Tnni3 (NM_017144) Rat Tagged ORF Clone

CAT#: RR206860

Reviews ()
Write a review
  • TrueORF®

Tnni3 (Myc-DDK-tagged ORF) - Rat troponin I type 3 (cardiac) (Tnni3), (10 ug)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 473.00


Availability*
4 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Tnni3
Synonyms cTNI; TnI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR206860 representing NM_017144
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATGAGAGCAGCGATGCGGCTGGGGAACCCCAGCCGGCGCCTGCTCCTGTCCGACGTCGCTCCT
CGGCCAACTACCGAGCCTATGCCACCGAGCCACATGCCAAGAAAAAGTCTAAGATCTCCGCCTCCAGAAA
ACTTCAGTTGAAGACTCTGATGCTGCAGATTGCGAAGCAGGAGATGGAGCGTGAGGCAGAGGAGCGACGT
GGAGAGAAGGGCCGCGTTCTGAGCACGCGTTGCCAGCCCTTGGTGTTGGATGGGCTGGGCTTTGAAGAGC
TTCAGGACCTATGCCGGCAGCTTCACGCTCGTGTGGACAAAGTGGATGAAGAGAGATACGACGTGGAAGC
AAAAGTCACCAAGAACATCACTGAGATTGCAGATCTGACCCAGAAGATCTATGACCTGCGTGGCAAGTTT
AAGCGGCCCACTCTCCGAAGAGTGAGAATCTCAGCAGATGCCATGATGCAGGCACTACTGGGGACCCGGG
CCAAGGAATCCTTGGACCTGAGGGCCCACCTCAAGCAGGTGAAGAAGGAGGACATTGAGAAGGAAAACCG
GGAGGTGGGAGACTGGCGCAAGAATATCGATGCACTAAGTGGAATGGAAGGCCGAAAGAAAAAGTTTGAG
GGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RR206860 representing NM_017144
Red=Cloning site Green=Tags(s)

MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERR
GEKGRVLSTRCQPLVLDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKF
KRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFE
G

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017144
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017144.2, NP_058840.1
RefSeq Size 829 bp
RefSeq ORF 636 bp
Locus ID 29248
UniProt ID P23693
Cytogenetics 1q12
MW 24.2 kDa
Gene Summary cardiac isoform of troponin I, which is a subunit of the troponin complex; inhibits actomyosin ATPase activity in muscle conraction [RGD, Feb 2006]
Other products for "Tnni3"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.