Cav1 (NM_031556) Rat Tagged ORF Clone

CAT#: RR200414

Cav1 (Myc-DDK-tagged ORF) - Rat caveolin 1, caveolae protein (Cav1), transcript variant 1, (10 ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cav1 (NM_031556) Rat Tagged ORF Clone
Symbol Cav1
Synonyms Cav; Cav
Vector pCMV6-Entry
Sequence Data
>RR200414 representing NM_031556
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGGGGTAAATACGTAGACTCCGAGGGACATCTCTACACTGTTCCCATCCGGGAACAGGGCAACA
TCTACAAGCCCAACAACAAGGCCATGGCAGACGAGGTGAATGAGAAGCAAGTGTACGACGCGCACACCAA
GGAGATTGATCTGGTCAACCGCGACCCCAAGCATCTCAACGACGACGTGGTCAAGATTGACTTTGAAGAT
GTGATTGCGGAACCAGAAGGGACACACAGTTTCGACGGCATCTGGAAGGCCAGCTTCACCACCTTCACTG
TGACAAAATATTGGTTTTACCGCTTGCTGTCTACCATCTTCGGCATCCCTATGGCGCTCATCTGGGGCAT
CTACTTTGCCATCCTCTCTTTCCTGCACATCTGGGCAGTTGTACCGTGCATCAAGAGCTTCCTGATTGAG
ATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCTTCTGTGATCCACTCTTTGAAGCGATTG
GCAAGATATTCAGCAATATCCGCATCAGCACGCAGAAAGAGATAGCAAGATATTCAGCAATATCCGCATC
AGCACGCAGAAAGAGATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR200414 representing NM_031556
Red=Cloning site Green=Tags(s)

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED
VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE
IQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEIARYSAISASARRKR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_031556
ORF Size 578 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_031556.2, NP_113744
RefSeq Size 2584
RefSeq ORF 537
Locus ID 25404
Cytogenetics 4q21
MW 21 kDa
Gene Summary structural protein of lipid raft domains in the membrane called caveolae; functions as a cholesterol-binding/shuttling protein [RGD, Feb 2006]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer protein (isoform alpha). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)