Aly(ALYREF) (NM_005782) Human Tagged ORF Clone

CAT#: RG229136

ALYREF (GFP-tagged) - Human THO complex 4 (THOC4)

Change vector?

  • TrueORF®

USD 443


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Aly(ALYREF) (NM_005782) Human Tagged ORF Clone
Symbol ALYREF
Synonyms ALY; ALY/REF; BEF; REF; THOC4
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG229136 representing NM_005782
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGATTCCGCGCCCGCCATGGCCGACAAAATGGACATGTCTCTGGACGACATCATTAAACTGAACC
GGAGCCAGCGAGGCGGCCGGGGCGGGGGCCGGGGCCGCGGCCGGGCCGGCTCCCAGGGCGGCCGCGGCGG
TGGGGCGCAGGCCGCCGCGCGAGTGAATCGAGGCGGCGGGCCCATCCGGAACCGGCCGGCCATCGCCCGC
GGCGCGGCCGGCGGAGGCGGCAGGAACCGACCGGCGCCCTACAGCAGGCCAAAACAACTTCCCGACAAGT
GGCAGCACGATCTTTTCGACAGTGGCTTCGGCGGTGGTGCCGGCGTGGAGACAGGTGGGAAACTGCTGGT
GTCCAATCTGGATTTTGGAGTCTCAGACGCCGATATTCAGGAACTCTTTGCTGAATTTGGAACGCTGAAG
AAGGCGGCTGTGCACTATGATCGCTCTGGTCGCAGCTTAGGAACAGCAGACGTGCACTTTGAGCGGAAGG
CAGATGCCCTGAAGGCCATGAAGCAGTACAACGGCGTCCCTCTGGATGGCCGCCCCATGAACATTCAGCT
TGTCACGTCACAGATTGACGCACAGCGGAGGCCTGCACAGAGCGTAAACAGAGGTGGCATGACTAGAAAC
CGTGGCGCTGGAGGTTTTGGTGGTGGTGGAGGCACCCGGAGAGGCACCCGCGGAGGCGCCCGTGGAAGAG
GCAGAGGTGCCGGCAGGAATTCAAAGCAGCAGCTTTCGGCAGAGGAGCTGGATGCCCAGCTGGACGCCTA
TAATGCGAGAATGGACACCAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG229136 representing NM_005782
Red=Cloning site Green=Tags(s)

MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIAR
GAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLK
KAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRN
RGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005782
ORF Size 792 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005782.3, NP_005773
RefSeq Size 1113
RefSeq ORF 795
Locus ID 10189
Cytogenetics 17q25.3
Protein Pathways Spliceosome
Gene Summary The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations