Aly (ALYREF) (NM_005782) Human Tagged ORF Clone

CAT#: RC229136

Reviews ()
Write a review
  • TrueORF®

ALYREF (Myc-DDK-tagged)-Human THO complex 4 (THOC4)



  "NM_005782" in other vectors (11)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Aly (ALYREF) (NM_005782) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ALYREF
Synonyms ALY; ALY/REF; BEF; REF; THOC4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC229136 representing NM_005782
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGATTCCGCGCCCGCCATGGCCGACAAAATGGACATGTCTCTGGACGACATCATTAAACTGAACC
GGAGCCAGCGAGGCGGCCGGGGCGGGGGCCGGGGCCGCGGCCGGGCCGGCTCCCAGGGCGGCCGCGGCGG
TGGGGCGCAGGCCGCCGCGCGAGTGAATCGAGGCGGCGGGCCCATCCGGAACCGGCCGGCCATCGCCCGC
GGCGCGGCCGGCGGAGGCGGCAGGAACCGACCGGCGCCCTACAGCAGGCCAAAACAACTTCCCGACAAGT
GGCAGCACGATCTTTTCGACAGTGGCTTCGGCGGTGGTGCCGGCGTGGAGACAGGTGGGAAACTGCTGGT
GTCCAATCTGGATTTTGGAGTCTCAGACGCCGATATTCAGGAACTCTTTGCTGAATTTGGAACGCTGAAG
AAGGCGGCTGTGCACTATGATCGCTCTGGTCGCAGCTTAGGAACAGCAGACGTGCACTTTGAGCGGAAGG
CAGATGCCCTGAAGGCCATGAAGCAGTACAACGGCGTCCCTCTGGATGGCCGCCCCATGAACATTCAGCT
TGTCACGTCACAGATTGACGCACAGCGGAGGCCTGCACAGAGCGTAAACAGAGGTGGCATGACTAGAAAC
CGTGGCGCTGGAGGTTTTGGTGGTGGTGGAGGCACCCGGAGAGGCACCCGCGGAGGCGCCCGTGGAAGAG
GCAGAGGTGCCGGCAGGAATTCAAAGCAGCAGCTTTCGGCAGAGGAGCTGGATGCCCAGCTGGACGCCTA
TAATGCGAGAATGGACACCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229136 representing NM_005782
Red=Cloning site Green=Tags(s)

MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIAR
GAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLK
KAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRN
RGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005782
ORF Size 792 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005782.3, NP_005773.3
RefSeq Size 1113 bp
RefSeq ORF 795 bp
Locus ID 10189
Cytogenetics 17q25.3
Protein Pathways Spliceosome
MW 27.6 kDa
Gene Summary The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ALYREF"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal antibody to ALY (THO complex 4)
    • 100 ul

USD 415.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools