PICK1 (NM_012407) Human Tagged ORF Clone

CAT#: RG222869

Reviews ()
Write a review
  • TrueORF®

PICK1 (tGFP-tagged) - Human protein interacting with PRKCA 1 (PICK1), transcript variant 1



Reconstitution Protocol

USD 657.00

3 Weeks*

Size
    • 10 ug

Product images

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PICK1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PICK1
Synonyms PICK; PRKCABP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG222869 representing NM_012407
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGCAGACTTGGATTATGACATCGAAGAGGATAAACTCGGAATCCCGACTGTGCCTGGGAAGGTGA
CCCTGCAGAAGGATGCTCAGAACCTGATCGGGATCAGCATTGGAGGAGGGGCCCAGTACTGTCCCTGCCT
CTATATCGTCCAGGTATTTGACAACACCCCAGCAGCCTTGGACGGCACAGTGGCAGCTGGCGATGAGATC
ACCGGTGTCAATGGCAGGTCAATCAAAGGGAAAACTAAGGTGGAGGTGGCGAAGATGATTCAGGAGGTGA
AGGGGGAGGTGACCATCCACTACAACAAGCTGCAGGCGGACCCCAAGCAGGGCATGTCCCTGGACATTGT
GTTGAAGAAAGTCAAGCACCGGCTGGTGGAGAACATGAGTTCAGGGACCGCAGATGCTCTGGGCCTGAGC
CGGGCCATCCTGTGCAATGATGGGCTTGTCAAGAGGCTAGAGGAGCTGGAGCGGACCGCTGAGCTATACA
AAGGGATGACGGAACACACCAAGAACCTCCTACGGGCCTTTTATGAGCTGTCGCAGACTCACCGGGCCTT
TGGGGACGTGTTCTCCGTGATCGGGGTGCGGGAGCCCCAGCCAGCTGCGAGCGAGGCTTTTGTGAAGTTC
GCCGATGCCCACCGCAGCATCGAGAAGTTCGGCATTCGGCTTCTGAAAACCATCAAGCCGATGCTGACGG
ATCTGAACACGTACCTCAACAAAGCCATCCCGGACACTCGCCTCACCATCAAGAAGTACCTGGACGTGAA
GTTTGAGTACCTGTCGTACTGCCTGAAGGTGAAGGAGATGGATGACGAGGAATACAGCTGCATTGCCCTA
GGCGAGCCCCTTTACCGGGTGAGCACCGGCAACTATGAGTACCGCCTGATCCTGCGCTGCCGCCAGGAGG
CGCGCGCCCGCTTCTCCCAGATGCGCAAGGATGTGCTGGAGAAGATGGAGCTGCTGGACCAGAAGCACGT
CCAGGACATCGTGTTCCAGCTGCAGCGCCTCGTGTCCACCATGTCCAAGTACTACAACGACTGCTACGCA
GTGCTGCGGGATGCCGACGTCTTCCCCATCGAGGTAGACCTGGCGCACACCACATTGGCCTATGGCCTCA
ACCAGGAGGAGTTCACAGATGGGGAGGAGGAGGAGGAGGAGGAAGACACGGCAGCTGGGGAGCCGTCCAG
GGATACACGAGGGGCTGCTGGGCCCTTGGACAAGGGTGGAAGCTGGTGTGACTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG222869 representing NM_012407
Red=Cloning site Green=Tags(s)

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI
TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS
RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKF
ADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIAL
GEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA
VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012407
ORF Size 1245 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012407.4
RefSeq Size 2083 bp
RefSeq ORF 1248 bp
Locus ID 9463
UniProt ID Q9NRD5
Cytogenetics 22q13.1
Domains PDZ
Protein Families Druggable Genome
Gene Summary The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.