CAMKK2 (NM_172216) Human Tagged ORF Clone

CAT#: RG219809

CAMKK2 (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 3

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 773.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CAMKK2 (NM_172216) Human Tagged ORF Clone
Symbol CAMKK2
Synonyms CAMKK; CAMKKB
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG219809 representing NM_172216
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCATCATGTGTCTCTAGCCAGCCCAGCAGCAACCGGGCCGCCCCCCAGGATGAGCTGGGGGGCAGGG
GCAGCAGCAGCAGCGAAAGCCAGAAGCCCTGTGAGGCCCTGCGGGGCCTCTCATCCTTGAGCATCCACCT
GGGCATGGAGTCCTTCATTGTGGTCACCGAGTGTGAGCCGGGCTGTGCTGTGGACCTCGGCTTGGCGCGG
GACCGGCCCCTGGAGGCCGATGGCCAAGAGGTCCCCCTTGACACCTCCGGGTCCCAGGCCCGGCCCCACC
TCTCCGGTCGCAAGCTGTCTCTGCAAGAGCGGTCCCAGGGTGGGCTGGCAGCCGGTGGCAGCCTGGACAT
GAACGGACGCTGCATCTGCCCGTCCCTGCCCTACTCACCCGTCAGCTCCCCGCAGTCCTCGCCTCGGCTG
CCCCGGCGGCCGACAGTGGAGTCTCACCACGTCTCCATCACGGGTATGCAGGACTGTGTGCAGCTGAATC
AGTATACCCTGAAGGATGAAATTGGAAAGGGCTCCTATGGTGTCGTCAAGTTGGCCTACAATGAAAATGA
CAATACCTACTATGCAATGAAGGTGCTGTCCAAAAAGAAGCTGATCCGGCAGGCCGGCTTTCCACGTCGC
CCTCCACCCCGAGGCACCCGGCCAGCTCCTGGAGGCTGCATCCAGCCCAGGGGCCCCATTGAGCAGGTGT
ACCAGGAAATTGCCATCCTCAAGAAGCTGGACCACCCCAATGTGGTGAAGCTGGTGGAGGTCCTGGATGA
CCCCAATGAGGACCATCTGTACATGGTGTTCGAACTGGTCAACCAAGGGCCCGTGATGGAAGTGCCCACC
CTCAAACCACTCTCTGAAGACCAGGCCCGTTTCTACTTCCAGGATCTGATCAAAGGCATCGAGTACTTAC
ACTACCAGAAGATCATCCACCGTGACATCAAACCTTCCAACCTCCTGGTCGGAGAAGATGGGCACATCAA
GATCGCTGACTTTGGTGTGAGCAATGAATTCAAGGGCAGTGACGCGCTCCTCTCCAACACCGTGGGCACG
CCCGCCTTCATGGCACCCGAGTCGCTCTCTGAGACCCGCAAGATCTTCTCTGGGAAGGCCTTGGATGTTT
GGGCCATGGGTGTGACACTATACTGCTTTGTCTTTGGCCAGTGCCCATTCATGGACGAGCGGATCATGTG
TTTACACAGTAAGATCAAGAGTCAGGCCCTGGAATTTCCAGACCAGCCCGACATAGCTGAGGACTTGAAG
GACCTGATCACCCGTATGCTGGACAAGAACCCCGAGTCGAGGATCGTGGTGCCGGAAATCAAGATCCTGG
TGAAGACCATGATACGTAAACGCTCCTTTGGGAACCCATTCGAGGGCAGCCGGCGGGAGGAACGCTCACT
GTCAGCGCCTGGAAACTTGCTCACCAAAAAACCAACCAGGGAATGTGAGTCCCTGTCTGAGCTCAAGGAA
GCAAGGCAGCGAAGACAACCTCCAGGGCACCGACCCGCCCCCCGTGGGGGAGGAGGAAGTGCTCTTGTGA
GAGGCAGTCCCTGCGTGGAAAGTTGCTGGGCCCCCGCCCCCGGCTCCCCCGCACGCATGCATCCACTGCG
GCCGGAGGAGGCCATGGAGCCCGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG219809 representing NM_172216
Red=Cloning site Green=Tags(s)

MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR
DRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL
PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR
PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT
LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT
PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKE
ARQRRQPPGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_172216
ORF Size 1635 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172216.1, NP_757365
RefSeq Size 5491
RefSeq ORF 1638
Locus ID 10645
Cytogenetics 12q24.31
Protein Families Protein Kinase, Transcription Factors, Druggable Genome
Protein Pathways Adipocytokine signaling pathway
Gene Summary The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations