CAMKK2 Rabbit Polyclonal Antibody

CAT#: TA337830

Rabbit Polyclonal Anti-CAMKK2 Antibody

Product Images

Host: Rabbit; Target Name: CAMKK2; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CAMKK2; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CAMKK2; Sample Tissue: Human Jurkat; Antibody Dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: CAMKK2; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B

• 

  Host: Rabbit; Target Name: CAMKK2; Sample Tissue: Human Hela; Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HeLa

• Host: Rabbit; Target Name: CAMKK2; Sample Tissue: Human HepG2; Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HepG2

Show all 7 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAMKK2 antibody: synthetic peptide directed towards the N terminal of human CAMKK2. Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: calcium/calmodulin-dependent protein kinase kinase 2
• Database Link:
  NP_705720
  Entrez Gene 10645 Human
  UniProt ID Q96RR4
• Background: CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases.
• Synonyms: CAMKK; CAMKKB
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transcription Factors
• Protein Pathways: Adipocytokine signaling pathway