OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAMKK2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337830
Rabbit Polyclonal Anti-CAMKK2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407016 Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP303468 Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7, 20 µg
20 ug
$737.00

View other "CAMKK2 or NM_153500" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CAMKK2 antibody: synthetic peptide directed towards the N terminal of human CAMKK2. Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name calcium/calmodulin-dependent protein kinase kinase 2
Database Link
Background CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases.
Synonyms CAMKK; CAMKKB
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Categories Enzyme: Kinases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Protein Kinase, Transcription Factors
Protein Pathways Adipocytokine signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products