ATOH1(ATOH1) (NM_005172) Human Tagged ORF Clone

CAT#: RG210192

ATOH1 (GFP-tagged) - Human atonal homolog 1 (Drosophila) (ATOH1)

Change vector?

  • TrueORF®

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ATOH1(ATOH1) (NM_005172) Human Tagged ORF Clone
Symbol ATOH1
Synonyms ATH1; bHLHa14; HATH1; MATH-1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG210192 representing NM_005172
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGCCTGCTGCATGCAGAAGAGTGGGCTGAAGTGAAGGAGTTGGGAGACCACCATCGCCAGCCCC
AGCCGCATCATCTCCCGCAACCGCCGCCGCCGCCGCAGCCACCTGCAACTTTGCAGGCGAGAGAGCATCC
CGTCTACCCGCCTGAGCTGTCCCTCCTGGACAGCACCGACCCACGCGCCTGGCTGGCTCCCACTTTGCAG
GGCATCTGCACGGCACGCGCCGCCCAGTATTTGCTACATTCCCCGGAGCTGGGTGCCTCAGAGGCCGCTG
CGCCCCGGGACGAGGTGGACGGCCGGGGGGAGCTGGTAAGGAGGAGCAGCGGCGGTGCCAGCAGCAGCAA
GAGCCCCGGGCCGGTGAAAGTGCGGGAACAGCTGTGCAAGCTGAAAGGCGGGGTGGTGGTAGACGAGCTG
GGCTGCAGCCGCCAACGGGCCCCTTCCAGCAAACAGGTGAATGGGGTGCAGAAGCAGAGACGGCTAGCAG
CCAACGCCAGGGAGCGGCGCAGGATGCATGGGCTGAACCACGCCTTCGACCAGCTGCGCAATGTTATCCC
GTCGTTCAACAACGACAAGAAGCTGTCCAAATATGAGACCCTGCAGATGGCCCAAATCTACATCAACGCC
TTGTCCGAGCTGCTACAAACGCCCAGCGGAGGGGAACAGCCACCGCCGCCTCCAGCCTCCTGCAAAAGCG
ACCACCACCACCTTCGCACCGCGGCCTCCTATGAAGGGGGCGCGGGCAACGCGACCGCAGCTGGGGCTCA
GCAGGCTTCCGGAGGGAGCCAGCGGCCGACCCCGCCCGGGAGTTGCCGGACTCGCTTCTCAGCCCCAGCT
TCTGCGGGAGGGTACTCGGTGCAGCTGGACGCTCTGCACTTCTCGACTTTCGAGGACAGCGCCCTGACAG
CGATGATGGCGCAAAAGAATTTGTCTCCTTCTCTCCCCGGGAGCATCTTGCAGCCAGTGCAGGAGGAAAA
CAGCAAAACTTCGCCTCGGTCCCACAGAAGCGACGGGGAATTTTCCCCCCATTCCCATTACAGTGACTCG
GATGAGGCAAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210192 representing NM_005172
Red=Cloning site Green=Tags(s)

MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQ
GICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDEL
GCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINA
LSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPA
SAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDS
DEAS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005172
ORF Size 1062 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005172.1, NP_005163
RefSeq Size 1065
RefSeq ORF 1065
Locus ID 474
Cytogenetics 4q22.2
Protein Families Transcription Factors, Druggable Genome
Gene Summary This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations