PADI4 (NM_012387) Human Tagged ORF Clone

CAT#: RG206501

PADI4 (GFP-tagged) - Human peptidyl arginine deiminase, type IV (PADI4)

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PADI4 (NM_012387) Human Tagged ORF Clone
Symbol PADI4
Synonyms PAD; PAD4; PADI5; PDI4; PDI5
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG206501 representing NM_012387
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGGGGACATTGATCCGTGTGACCCCAGAGCAGCCCACCCATGCCGTGTGTGTGCTGGGCACCT
TGACTCAGCTTGACATCTGCAGCTCTGCCCCTGAGGACTGCACGTCCTTCAGCATCAACGCCTCCCCAGG
GGTGGTCGTGGATATTGCCCACAGCCCTCCAGCCAAGAAGAAATCCACAGGTTCCTCCACATGGCCCCTG
GACCCTGGGGTAGAGGTGACCCTGACGATGAAAGCGGCCAGTGGTAGCACAGGCGACCAGAAGGTTCAGA
TTTCATACTACGGACCCAAGACTCCACCAGTCAAAGCTCTACTCTACCTCACCGCGGTGGAAATCTCCCT
GTGCGCAGACATCACCCGCACCGGCAAAGTGAAGCCAACCAGAGCTGTGAAAGATCAGAGGACCTGGACC
TGGGGCCCTTGTGGACAGGGTGCCATCCTGCTGGTGAACTGTGACAGAGACAATCTCGAATCTTCTGCCA
TGGACTGCGAGGATGATGAAGTGCTTGACAGCGAAGACCTGCAGGACATGTCGCTGATGACCCTGAGCAC
GAAGACCCCCAAGGACTTCTTCACAAACCATACACTGGTGCTCCACGTGGCCAGGTCTGAGATGGACAAA
GTGAGGGTGTTTCAGGCCACACGGGGCAAACTGTCCTCCAAGTGCAGCGTAGTCTTGGGTCCCAAGTGGC
CCTCTCACTACCTGATGGTCCCCGGTGGAAAGCACAACATGGACTTCTACGTGGAGGCCCTCGCTTTCCC
GGACACCGACTTCCCGGGGCTCATTACCCTCACCATCTCCCTGCTGGACACGTCCAACCTGGAGCTCCCC
GAGGCTGTGGTGTTCCAAGACAGCGTGGTCTTCCGCGTGGCGCCCTGGATCATGACCCCCAACACCCAGC
CCCCGCAGGAGGTGTACGCGTGCAGTATTTTTGAAAATGAGGACTTCCTGAAGTCAGTGACTACTCTGGC
CATGAAAGCCAAGTGCAAGCTGACCATCTGCCCTGAGGAGGAGAACATGGATGACCAGTGGATGCAGGAT
GAAATGGAGATCGGCTACATCCAAGCCCCACACAAAACACTGCCCGTGGTCTTCGACTCTCCAAGGAACA
GAGGCCTGAAGGAGTTTCCCATCAAACGAGTGATGGGTCCAGATTTTGGCTATGTAACTCGAGGGCCCCA
AACAGGGGGTATCAGTGGACTGGACTCCTTTGGGAACCTGGAAGTGAGCCCCCCAGTCACAGTCAGGGGC
AAGGAATACCCGCTGGGCAGGATTCTCTTCGGGGACAGCTGTTATCCCAGCAATGACAGCCGGCAGATGC
ACCAGGCCCTGCAGGACTTCCTCAGTGCCCAGCAGGTGCAGGCCCCTGTGAAGCTCTATTCTGACTGGCT
GTCCGTGGGCCACGTGGACGAGTTCCTGAGCTTTGTGCCAGCACCCGACAGGAAGGGCTTCCGGCTGCTC
CTGGCCAGCCCCAGGTCCTGCTACAAACTGTTCCAGGAGCAGCAGAATGAGGGCCACGGGGAGGCCCTGC
TGTTCGAAGGGATCAAGAAAAAAAAACAGCAGAAAATAAAGAACATTCTGTCAAACAAGACATTGAGAGA
ACATAATTCATTTGTGGAGAGATGCATCGACTGGAACCGCGAGCTGCTGAAGCGGGAGCTGGGCCTGGCC
GAGAGTGACATCATTGACATCCCGCAGCTCTTCAAGCTCAAAGAGTTCTCTAAGGCGGAAGCTTTTTTCC
CCAACATGGTGAACATGCTGGTGCTAGGGAAGCACCTGGGCATCCCCAAGCCCTTCGGGCCCGTCATCAA
CGGCCGCTGCTGCCTGGAGGAGAAGGTGTGTTCCCTGCTGGAGCCACTGGGCCTCCAGTGCACCTTCATC
AACGACTTCTTCACCTACCACATCAGGCATGGGGAGGTGCACTGCGGCACCAACGTGCGCAGAAAGCCCT
TCTCCTTCAAGTGGTGGAACATGGTGCCC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG206501 representing NM_012387
Red=Cloning site Green=Tags(s)

MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPL
DPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYLTAVEISLCADITRTGKVKPTRAVKDQRTWT
WGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDK
VRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELP
EAVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQD
EMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG
KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLL
LASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA
ESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFI
NDFFTYHIRHGEVHCGTNVRRKPFSFKWWNMVP

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_012387
ORF Size 1989 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012387.1, NP_036519
RefSeq Size 2263
Locus ID 23569
Cytogenetics 1p36.13
Domains PAD
Gene Summary This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.