LRRC50(DNAAF1) (NM_178452) Human Tagged ORF Clone

CAT#: RG205452

DNAAF1 (GFP-tagged) - Human leucine rich repeat containing 50 (LRRC50)

Change vector?

  • TrueORF®

USD 629


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name LRRC50(DNAAF1) (NM_178452) Human Tagged ORF Clone
Symbol DNAAF1
Synonyms CILD13; LRRC50; ODA7; swt
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG205452 representing NM_178452
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACCCTGAGCCCTCGGAGCCTGCGACAGGTGGTGCAGCAGAGCTGGATTGCGCGCAGGAGCCCGGCG
TGGAGGAGTCTGCGGGTGACCACGGGAGCGCAGGCCGAGGGGGCTGCAAGGAAGAAATTAATGATCCTAA
GGAAATATGTGTGGGTTCTTCTGACACATCCTACCACAGCCAGCAGAAACAGAGTGGTGATAATGGGTCA
GGTGGTCACTTCGCACACCCAAGAGAAGACAGGGAAGATCGGGGCCCCAGAATGACTAAAAGTTCCCTGC
AAAAACTCTGCAAGCAGCACAAGCTTTATATTACCCCAGCATTGAATGATACGCTGTATTTACACTTTAA
AGGTTTTGATCGCATTGAGAACCTGGAAGAGTACACAGGGCTGCGCTGTCTCTGGCTGCAGAGCAATGGA
ATACAGAAAATCGAAAACCTGGAGGCCCAAACTGAGTTGCGTTGCCTCTTCTTGCAAATGAACTTGCTCC
GTAAAATTGAGAACCTGGAACCTCTGCAGAAACTGGATGCTCTTAACCTCAGCAACAATTACATCAAGAC
CATTGAAAACCTCTCCTGCCTCCCAGTCCTGAACACATTGCAGATGGCCCACAATCACCTGGAGACCGTG
GAGGACATTCAGCATCTACAAGAGTGTTTGAGGCTTTGTGTCCTTGACCTTTCGCACAACAAGCTGAGTG
ACCCGGAGATCCTGAGCATTCTGGAAAGCATGCCCGATTTGCGTGTACTGAATTTGATGGGAAACCCGGT
TATCAGACAGATTCCTAATTACAGAAGGACAGTCACTGTACGACTAAAGCACTTAACATACCTGGATGAT
AGACCAGTGTTTCCAAAGGACAGAGCTTGTGCGGAGGCCTGGGCTAGGGGAGGGTACGCAGCTGAAAAGG
AGGAGAGACAGCAGTGGGAGAGCAGGGAGCGGAAGAAGATCACAGACAGCATTGAAGCCTTGGCCATGAT
CAAGCAGCGGGCAGAGGAGAGGAAAAGACAGAGAGAGAGTCAAGAGAGAGGGGAGATGACATCTTCAGAT
GATGGTGAGAATGTGCCCGCCAGTGCGGAAGGCAAGGAGGAGCCTCCCGGGGACAGAGAAACAAGGCAGA
AGATGGAGCTATTTGTTAAGGAAAGCTTTGAGGCCAAGGACGAGCTCTGCCCGGAAAAGCCAAGTGGAGA
GGAGCCGCCTGTGGAGGCTAAAAGAGAGGATGGAGGTCCAGAGCCAGAGGGGACCCTCCCAGCTGAGACC
CTGCTACTGTCGTCACCTGTGGAGGTTAAAGGAGAGGACGGAGATGGAGAGCCAGAGGGGACCCTCCCAG
CTGAGGCCCCACCACCCCCGCCACCTGTGGAGGTTAAAGGAGAGGATGGAGATCAAGAGCCAGAGGGGAC
CCTCCCAGCTGAGACCCTGCTACTGTCACCGCCTGTGAAGGTTAAAGGAGAGGATGGAGATCGAGAGCCA
GAGGGGACCCTCCCAGCTGAGGCCCCACCACCACCGCCCCTGGGAGCTGCCAGGGAAGAACCGACTCCCC
AGGCTGTGGCCACTGAGGGTGTATTCGTTACAGAACTTGATGGAACGAGAACGGAAGATTTAGAAACCAT
TAGACTGGAGACAAAGGAGACATTCTGCATTGATGACCTACCTGACTTGGAAGATGATGATGAAACAGGC
AAATCTCTGGAAGACCAGAATATGTGCTTTCCGAAGATTGAGGTCATCTCGAGCTTGAGTGATGACAGTG
ACCCTGAACTGGACTACACGTCACTCCCTGTGCTGGAAAACCTCCCCACAGACACTCTGTCAAATATATT
TGCAGTCTCTAAAGACACCTCAAAGGCGGCTCGGGTGCCCTTCACAGACATCTTTAAAAAAGAAGCTAAG
AGGGACTTGGAAATCCGAAAACAAGACACCAAGTCCCCAAGACCCCTGATCCAGGAGCTCAGCGACGAGG
ACCCCTCTGGCCAGCTACTGATGCCCCCCACCTGCCAAAGAGATGCTGCACCACTCACTTCCAGTGGAGA
CAGGGACAGCGACTTCCTTGCAGCCTCTTCTCCGGTGCCGACTGAGAGCGCCGCCACACCCCCAGAGACG
TGTGTCGGAGTTGCCCAGCCCAGCCAAGCTCTGCCCACGTGGGACCTCACTGCATTCCCAGCACCGAAAG
CATCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205452 representing NM_178452
Red=Cloning site Green=Tags(s)

MHPEPSEPATGGAAELDCAQEPGVEESAGDHGSAGRGGCKEEINDPKEICVGSSDTSYHSQQKQSGDNGS
GGHFAHPREDREDRGPRMTKSSLQKLCKQHKLYITPALNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNG
IQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETV
EDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLTYLDD
RPVFPKDRACAEAWARGGYAAEKEERQQWESRERKKITDSIEALAMIKQRAEERKRQRESQERGEMTSSD
DGENVPASAEGKEEPPGDRETRQKMELFVKESFEAKDELCPEKPSGEEPPVEAKREDGGPEPEGTLPAET
LLLSSPVEVKGEDGDGEPEGTLPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVKVKGEDGDREP
EGTLPAEAPPPPPLGAAREEPTPQAVATEGVFVTELDGTRTEDLETIRLETKETFCIDDLPDLEDDDETG
KSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFKKEAK
RDLEIRKQDTKSPRPLIQELSDEDPSGQLLMPPTCQRDAAPLTSSGDRDSDFLAASSPVPTESAATPPET
CVGVAQPSQALPTWDLTAFPAPKAS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_178452
ORF Size 2175 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_178452.4, NP_848547
RefSeq Size 2451
RefSeq ORF 2178
Locus ID 123872
Cytogenetics 16q24.1
Gene Summary The protein encoded by this gene is cilium-specific and is required for the stability of the ciliary architecture. It is involved in the regulation of microtubule-based cilia and actin-based brush border microvilli. Mutations in this gene are associated with primary ciliary dyskinesia-13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations