AMY2B (NM_020978) Human Tagged ORF Clone

CAT#: RG203812

AMY2B (GFP-tagged) - Human amylase, alpha 2B (pancreatic) (AMY2B)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AMY2B (NM_020978) Human Tagged ORF Clone
Symbol AMY2B
Synonyms AMY2; AMY3; HXA
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG203812 representing NM_020978
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTCTTTCTGTTGCTTTTCACCATTGGGTTCTGCTGGGCTCAGTATTCCCCAAATACACAACAAG
GACGGACATCTATTGTTCATCTGTTTGAATGGCGATGGGTTGATATTGCTCTTGAATGTGAGCGATATTT
AGCTCCCAAGGGATTTGGAGGGGTTCAGGTCTCTCCACCAAATGAAAATGTTGCAATTCACAACCCTTTC
AGACCTTGGTGGGAAAGATACCAACCAGTTAGCTATAAATTATGCACAAGATCTGGAAATGAAGATGAAT
TTAGAAACATGGTGACTAGATGTAACAATGTTGGGGTTCGTATTTATGTGGATGCTGTAATTAATCATAT
GTCTGGTAATGCTGTGAGTGCAGGAACAAGCAGTACCTGTGGAAGTTACTTCAACCCTGGAAGTAGGGAC
TTTCCAGCAGTCCCATATTCTGGATGGGATTTTAATGATGGTAAATGTAAAACTGGAAGTGGAGATATCG
AGAACTACAATGATGCTACTCAGGTCAGAGATTGTCGTCTGGTTGGTCTTCTTGATCTTGCACTGGAGAA
AGATTATGTGCGTTCCAAGATTGCCGAATATATGAATCATCTCATTGACATTGGTGTTGCAGGGTTCAGA
CTTGATGCTTCCAAGCACATGTGGCCTGGAGACATAAAGGCAATTTTGGACAAACTGCATAATCTAAACA
GTAACTGGTTCCCTGCAGGAAGTAAACCTTTCATTTACCAGGAGGTAATTGATCTGGGTGGTGAGCCAAT
TAAAAGCAGTGACTACTTTGGAAATGGCCGGGTGACAGAATTCAAGTATGGTGCAAAACTCGGCACAGTT
ATTCGCAAGTGGAATGGAGAGAAGATGTCTTACCTAAAGAACTGGGGAGAAGGTTGGGGTTTCATGCCTT
CTGACAGAGCACTTGTCTTTGTGGATAACCATGACAATCAACGAGGACATGGGGCTGGAGGAGCCTCTAT
TCTTACCTTCTGGGATGCTAGGCTGTATAAAATGGCAGTTGGATTTATGCTTGCTCATCCTTATGGTTTT
ACACGAGTAATGTCAAGCTACCGTTGGCCAAGACAGTTTCAAAATGGAAACGATGTTAATGATTGGGTTG
GGCCACCAAATAATAATGGAGTAATTAAAGAAGTTACTATTAATCCAGACACTACTTGTGGCAATGACTG
GGTCTGTGAACATCGATGGCGCCAAATAAGGAACATGGTTAATTTCCGCAATGTAGTGGATGGCCAGCCT
TTTACAAACTGGTATGATAATGGGAGCAACCAAGTGGCTTTTGGGAGAGGAAACAGAGGATTCATTGTTT
TCAACAATGATGACTGGACATTTTCTTTAACTTTGCAAACTGGTCTTCCTGCTGGCACATACTGTGATGT
CATTTCTGGAGATAAAATTAATGGCAATTGCACAGGCATTAAAATCTACGTTTCTGACGATGGCAAAGCT
CATTTTTCTATTAGTAACTCTGCTGAGGATCCATTTATTGCAATTCATGCTGAATCTAAATTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203812 representing NM_020978
Red=Cloning site Green=Tags(s)

MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF
RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRD
FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR
LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV
IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF
TRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA
HFSISNSAEDPFIAIHAESKL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_020978
ORF Size 1533 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020978.3, NP_066188
RefSeq Size 2215
RefSeq ORF 1536
Locus ID 280
Cytogenetics 1p21.1
Domains alpha-amylase, Aamy_C, Aamy
Protein Families Secreted Protein
Protein Pathways Starch and sucrose metabolism, Metabolic pathways
Gene Summary Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jun 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations