AMY2B (NM_020978) Human Tagged ORF Clone

CAT#: RG203812

Reviews ()
Write a review
  • TrueORF®

AMY2B (GFP-tagged) - Human amylase, alpha 2B (pancreatic) (AMY2B)



  "NM_020978" in other vectors (4)

USD 530.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name AMY2B (NM_020978) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AMY2B
Synonyms AMY2; AMY3; HXA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG203812 representing NM_020978
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTCTTTCTGTTGCTTTTCACCATTGGGTTCTGCTGGGCTCAGTATTCCCCAAATACACAACAAG
GACGGACATCTATTGTTCATCTGTTTGAATGGCGATGGGTTGATATTGCTCTTGAATGTGAGCGATATTT
AGCTCCCAAGGGATTTGGAGGGGTTCAGGTCTCTCCACCAAATGAAAATGTTGCAATTCACAACCCTTTC
AGACCTTGGTGGGAAAGATACCAACCAGTTAGCTATAAATTATGCACAAGATCTGGAAATGAAGATGAAT
TTAGAAACATGGTGACTAGATGTAACAATGTTGGGGTTCGTATTTATGTGGATGCTGTAATTAATCATAT
GTCTGGTAATGCTGTGAGTGCAGGAACAAGCAGTACCTGTGGAAGTTACTTCAACCCTGGAAGTAGGGAC
TTTCCAGCAGTCCCATATTCTGGATGGGATTTTAATGATGGTAAATGTAAAACTGGAAGTGGAGATATCG
AGAACTACAATGATGCTACTCAGGTCAGAGATTGTCGTCTGGTTGGTCTTCTTGATCTTGCACTGGAGAA
AGATTATGTGCGTTCCAAGATTGCCGAATATATGAATCATCTCATTGACATTGGTGTTGCAGGGTTCAGA
CTTGATGCTTCCAAGCACATGTGGCCTGGAGACATAAAGGCAATTTTGGACAAACTGCATAATCTAAACA
GTAACTGGTTCCCTGCAGGAAGTAAACCTTTCATTTACCAGGAGGTAATTGATCTGGGTGGTGAGCCAAT
TAAAAGCAGTGACTACTTTGGAAATGGCCGGGTGACAGAATTCAAGTATGGTGCAAAACTCGGCACAGTT
ATTCGCAAGTGGAATGGAGAGAAGATGTCTTACCTAAAGAACTGGGGAGAAGGTTGGGGTTTCATGCCTT
CTGACAGAGCACTTGTCTTTGTGGATAACCATGACAATCAACGAGGACATGGGGCTGGAGGAGCCTCTAT
TCTTACCTTCTGGGATGCTAGGCTGTATAAAATGGCAGTTGGATTTATGCTTGCTCATCCTTATGGTTTT
ACACGAGTAATGTCAAGCTACCGTTGGCCAAGACAGTTTCAAAATGGAAACGATGTTAATGATTGGGTTG
GGCCACCAAATAATAATGGAGTAATTAAAGAAGTTACTATTAATCCAGACACTACTTGTGGCAATGACTG
GGTCTGTGAACATCGATGGCGCCAAATAAGGAACATGGTTAATTTCCGCAATGTAGTGGATGGCCAGCCT
TTTACAAACTGGTATGATAATGGGAGCAACCAAGTGGCTTTTGGGAGAGGAAACAGAGGATTCATTGTTT
TCAACAATGATGACTGGACATTTTCTTTAACTTTGCAAACTGGTCTTCCTGCTGGCACATACTGTGATGT
CATTTCTGGAGATAAAATTAATGGCAATTGCACAGGCATTAAAATCTACGTTTCTGACGATGGCAAAGCT
CATTTTTCTATTAGTAACTCTGCTGAGGATCCATTTATTGCAATTCATGCTGAATCTAAATTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203812 representing NM_020978
Red=Cloning site Green=Tags(s)

MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF
RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRD
FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR
LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV
IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF
TRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA
HFSISNSAEDPFIAIHAESKL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_020978
ORF Size 1533 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020978.3, NP_066188.1
RefSeq Size 2215 bp
RefSeq ORF 1536 bp
Locus ID 280
Cytogenetics 1p21.1
Domains alpha-amylase, Aamy_C, Aamy
Protein Families Secreted Protein
Protein Pathways Metabolic pathways, Starch and sucrose metabolism
Gene Summary Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jun 2013]

Citations (1)

Other Versions

Other products for "AMY2B"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


AMY2B mouse monoclonal antibody,clone OTI4B5
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools